PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.BVL00
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 496aa    MW: 54840.7 Da    PI: 6.8795
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.BVL00genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding543.7e-1783127147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +WT+eE+e++++a k++G g W+ I +++g ++t+ q++s+ qk+
      Aradu.BVL00  83 REKWTEEEHEKFLEALKLYGRG-WRQIEEHIG-TKTAVQIRSHAQKF 127
                      789*******************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.14E-1677130IPR009057Homeodomain-like
PROSITE profilePS5129421.3378132IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.6E-1080130IPR009057Homeodomain-like
TIGRFAMsTIGR015574.0E-1681130IPR006447Myb domain, plants
SMARTSM007173.6E-1382130IPR001005SANT/Myb domain
PfamPF002491.3E-1483126IPR001005SANT/Myb domain
CDDcd001671.97E-1185128No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 496 aa     Download sequence    Send to blast
MIQFSNMLVG LVPVKLRVFT RTGSDFAPME MQDQIEGTKL SKSGTASDCH SNDGSQSQSP  60
DISSVVNNHA PKVRKPYTIT KQREKWTEEE HEKFLEALKL YGRGWRQIEE HIGTKTAVQI  120
RSHAQKFFSK VVRDSDGSAE SSIHPIDIPP PRPKRKPLHP YPRKLANSFK RHSIPNEPEK  180
SPSPNLSSAE KDSQSPTSVL SAFGSEAFGS AFSEQTNRCL SPNSCTTDIQ SINLSPIEKE  240
NDCMTSKPSK EEDKTPLASA PLSISSQPYL HMKSEKLELC SKQTKCINND VVNVLPTTIK  300
LFGRTVSMVG NQESINTEEE CVKLCITRSD EVDDVENQLN TQLSLGMCNG SWQVMPKEAI  360
VKEDLGLGES APEASLSWSS WFPGGPAAYF GSSNTVVNPM PLHPSLKVRT REEEGSCTGS  420
NGESVNDVEI QGKIQGRFLD TVDSRCQQTS HQEEVVVPQK SPRGFVPYKR CLAERDASSL  480
IVALEERKGQ RARVCS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00146DAPTransfer from AT1G18330Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015967014.10.0PREDICTED: protein REVEILLE 7-like isoform X1
SwissprotB3H5A83e-67RVE7_ARATH; Protein REVEILLE 7
TrEMBLA0A0B2QSV00.0A0A0B2QSV0_GLYSO; Myb-like protein G
TrEMBLI1MQL70.0I1MQL7_SOYBN; Uncharacterized protein
STRINGGLYMA16G34340.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73133244
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18330.22e-61MYB_related family protein